All Categories

Languages

Currency

IGF-1 DES 1mg

Uncategorized

IGF-1 DES 1mg

IGF-1 DES, a potent form of Insulin-like Growth Factor 1, enhances muscle growth and repair, improves fat metabolism, accelerates recovery, provides neuroprotective effects, and supports bone health (PMID: 21135066,PMID: 8970554, PMID: 31525624, PMID: 8603600, PMID: 25147565 ).

IGF-1 DES, a truncated form of Insulin-like Growth Factor 1, has several notable benefits:

  1. Enhanced Muscle Growth and Repair: IGF-1 DES is significantly more potent than IGF-1 in promoting muscle hypertrophy. It stimulates muscle cell proliferation and differentiation, leading to increased muscle mass and strength, making it popular among bodybuilders and athletes​ (PMID: 21135066)​.
  2. Improved Fat Metabolism: This peptide enhances fat breakdown and reduces fat storage, which helps in improving body composition and reducing overall body fat​ (PMID: 8970554)​.
  3. Accelerated Recovery: IGF-1 DES aids in faster recovery from exercise and injuries by promoting cellular repair processes and reducing muscle damage​ (PMID: 31525624)​.
  4. Neuroprotective Effects: It has shown potential in protecting neurons from damage, which could be beneficial in neurodegenerative conditions​ (PMID: 8603600)​.
  5. Bone Health: IGF-1 DES supports bone growth and repair, contributing to stronger bones and potentially aiding in the treatment of conditions like osteoporosis​ (PMID: 25147565)​.

Peer-Reviewed Studies 

Pan, W., & Kastin, A. J. (2000) Neuroendocrinology, 72(3), 171-178.

Kummer, A., Pulford, B. E., Ishii, D. N., & Seigel, G. M. (2003). Experimental Diabesity Research, 4(1), 45-57.

 

Structure

Sequence:

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKS

A Molecular Formula: C H N O S

Molecular Weight: 7365.4225 g/mol

PubChem CID: 135331146

CAS Number: 112603-35-7

Synonyms: Insulin-like growth factor 1, des-(1-3)-, Des(1-3) IGF-1, 4-70-insulin-like growth factor 1

IGF-1 DES Research

IGF-1 DES Is More Potent Than IGF-1

IGF-1 DES lacks just three amino acids from its N-terminal end, but that subtle change makes a big difference. Research shows that IGF-1 DES does not bind very well to IGF-1 binding proteins (IGFBPs) found in the blood and in various tissues throughout the body. The result is that more of the peptide is available for binding to important receptors and thus IGF-1 DES is more potent (same effects at lower doses) than IGF-1 itself. Research in pigs and marmosets indicates that IGF-1 DES is 2-3 times more potent than IGF-1 in lowering blood sugar. Further, these same potency effects extend to other properties of IGF-1 as well, including its anabolic effects on skeletal muscle and its neuroprotective effects [2].

One of the benefits of binding to IGFBPs is prolonged activity as a result of decreased clearance from the circulation. Thus, IGF-1 DES has a much faster onset of action, higher peak activity, and faster withdrawal than IGF-1 itself. There are a number of settings in which this type of efficacy profile could be useful, including the treatment of hyperglycemic conditions.

Research in pigs indicates that IGF-1 variants with low affinities for IGFBPs have a more dramatic effect on growth. In fact, the anabolic effects of IGF-1 DES occur even in the setting of limited calorie intake[3]. Research in rats shows that just 14 days of IGF-1 DES is enough to produce significant increases in body weight, nitrogen retention, and food conversion efficiency[4]. The latter fact is important as it confirms the potential of IGF-1 DES to improve anabolism even in the setting of poor calorie intake, a function that would make the peptide useful in chronic disease and in individuals who are unable to consume a great deal of calories for a variety of reasons. IGF-1 has also been shown to be a more effective antihyperglycemic agent, lower blood sugar rapid after administration. This is part of the reason the peptide is so efficient in boosting growth with lower calorie consumption. There is interest among researchers in using IGF-1 DES as a potential treatment in hyperglycemia were it would have similar effects to insulin administration without the long-term side effects that can occur if too much insulin is used.

IGF-1 DES Research and Neurological Disease

It has been long established that IGF-1 has important effects on neuron growth, differentiation, and survival. The protein is a major factor in synaptic formation and thus plays a critical role in learning, memory, and more. IGF-1 is particularly important for the development and maintenance of mature synapses. Research shows that IGF-1 is absolutely necessary for achieving proper levels of presynaptic synapsin-1, a protein that regulates the release of neurotransmitters. The peptide is also important for the post-synaptic PSD-95 protein, which maintains synaptic structure. Without IGF-1, synaptic development is disrupted and deficits in motor skills, behavior, cognitive functioning, and language all develop.

Source: Pubmed
IGF-1 and its analogues have been tested in Rett syndrome and in chromosome 22 deletion syndrome. In both cases, the peptides yield positive benefits. By protecting the number of excitatory synapses in the brain and by preserving neuron density. IGF-1 has also been shown to reduce the toxic effects of NDMA over-stimulation, thereby protecting neurons from excitotoxicity, which can lead to neuron death. The benefits were so great in animal studies that IGF-1 and its analogues are being introduced as experimental treatments in humans suffering from these devastating conditions[5].
Clinical trials of IGF-1 in multiple sclerosis (MS), ALS, Parkinson’s disease (PD), and Alzheimer’s disease (AD) have yielded mixed results. In ALS, for instance, IGF-1 treatment lead to significant reductions in disease progression, increased muscle strength, improved respiratory functioning, and increased quality of life. In MS, the peptide had almost no effect. Human trials of IGF-1 in PD have not yet been performed, but studies in rat models of PD indicate that it protects dopaminergic neurons and improves behavior[6]. Further study is required to understand the causes of these conditions and how IGF-1 DES plays a role in their treatment. The fact that the peptide has no impact on MS is not surprising as the condition is less caused by neuron death than by damage to the cells around neurons. IGF-1 DES and other IGF-1 analogues can help scientists to explore the basic pathophysiology of these conditions in order to better under their causes and thus develop potential treatments.
IGF-1 DES and Autism
Research shows that IGF-1 may be an important constituent in a number of neurological conditions, including autism. In fact, children with autism show lower brain levels of IGF-1 than age-matched controls, suggesting that low IGF-1 concentrations in the brain, particularly at an early age, may disrupt normal development and be important in the pathogenesis of autism [7].
Research in mouse models of autism indicate that IGF-II and analogues like IGF-1 DES reverse all deficits associated with the conditions. Mice administered IGF-II for just five days showed improved social interaction, better novel-object recognition, enhanced contextual fear conditioning, reduced repetitive/compulsive behavior, better grooming, and more. The mice even showed improve memory[8].
These findings should not come as any surprise as research suggests that autism is likely caused by disruptions in synapse development and is similar pathologically, to other neurodevelopmental conditions like fragile X syndrome, tuberous sclerosis, and Angelman syndrome. IGF-1 and its analogues, which have potent effects on synapses, are therefore ideal candidates for exploring various treatment strategies in these disorders[9].
IGF-1 DES May Have Cognitive Benefits in Age
IGF-1 is important in adults as well as children. In adults, the peptide is actually heavily modified in the brain to make it shorter, indicating that analogues like IGF-1 DES may have better therapeutic potential than intact IGF-1. Molecules like IGF-1 DES also penetrate the blood-brain barrier more readily, making them more effective when administered exogenously. In adults, IGF-1 and its analogues have been shown to reduce neuronal death and protect neurons against insults like stroke, Alzheimer’s disease, Parkinson’s disease, and more[10].
From the above, it is clear that IGF-1 and its analogues are useful in the setting of neurological disease. Research in rats, however, suggests that IGF-1 DES may enhance synaptic transmission and impart cognitive benefits even in normal rats. This could be of benefit to learning and memory, particularly as organisms age and natural levels of IGF-1 in the brain begin to decline. According to research, IGF-1 DES causes a 40% increase in excitatory post-synaptic potential[11]. This suggests that the peptide could have profound effects on cognitive function, particularly in age-related synaptic dysfunction.

IGF-1 DES Research and Immune Function

Many cells in the immune system, such as mononuclear cells and neutrophils, have IGF-1 receptors on their surface. Research shows that IGF-1 DES can improve immune function by boosting release of hydrogen peroxide in mononuclear cells and by encouraging neutrophils to differentiate into pathogen-killing blastocytes[12]. In all cases, IGF-1 DES is more potent in stimulating these changes than IGF-1, indicating that the peptide might be an effective adjuvant to antibiotics and other treatments used in the setting of infectious disease. Research into the role of IGF-1 DES in stimulating immune function is very preliminary, but still very promising.

IGF-1 DES May Improve Wound Healing

Dermal (skin) fibroblasts are the cell primarily responsible for tissue repair following injury. These cells turn out to produce a number of IGFBPs under certain circumstances and it is known that this protein drastically lowers the impact of IGF-1 at its other receptors. Research suggests that inflammatory cytokines can alter IGFBP levels, which may impact healing. By administering peptides that are unaffected by IGFBP, it is possible to circumvent the effects of inflammatory cytokines and improve fibroblast growth and differentiation[13]. This, in turn, can accelerate wound healing.

IGF-1 DES Research and Cancer

One of the problems that cancer cells present is the fact that they are undifferentiated or exist at very earlier stages of differentiation. This makes the cells difficult to treat and also makes them dysfunctional. Most importantly, cells in later stages of differentiation grow more slowly. Forcing cancer cells to differentiate could slower tumor growth. Research in cell culture indicates that IGF-1 DES can force certain types of cancer cell to differentiate, which slows tumor growth by inhibiting differentiation[14].

IGF-1 DES Is a New Contender

IGF-1 DES preserves many of the functions of IGF-1, such as enhanced skeletal muscle growth and protection of neurons. It is different, however, in that it does not bind to IGFBPs. This fact alone makes IGF-1 DES more useful in a number of ways, such as allowing the peptide to more easily pass into the brain when administered exogenously. IGF-1 DES hold a great deal of promise, which is why it is the subject of intense research in fields that touch on neurodevelopment, stroke, cancer, wound healing, autism, and more.
IGF-1 DES exhibits moderate side effects, low oral and excellent subcutaneous bioavailability in mice. Per kg dosage in mice does not scale to humans. IGF-1 DES for sale at Life Link Research is limited to educational and scientific research only, not for human consumption.

Article Author

The above literature was researched, edited and organized by Dr. Logan, M.D. Dr. Logan holds a doctorate degree from Case Western Reserve University School of Medicine and a B.S. in molecular biology.

Scientific Journal Author

Dr. Clemmons’ clinical practice combines his interest in growth hormone and IGF-I with the assessment of patients with hypopituitarism and patients with pituitary tumors that hypersecrete growth hormone or prolactin. Dr. Clemmons combines basic biomedical research, clinical investigation and consultative endocrinology practice as well as clinical education. His basic research involves understanding the molecular mechanisms by which insulin-like growth factors stimulate cellular proliferation and differentiation. Dr. Clemmons is also interested in how cells that are undergoing hyperglycemic stress respond aberrantly to stimulation by these growth factors. Additionally, he is interested in the mechanisms by which these factors stimulate differentiation particularly in osteoblasts and vascular cells. His clinical studies involve novel methods for reversing the effect of these factors in patients with diabetic nephropathy and retinopathy. In his clinical practice he combines his interest in growth hormone and IGF-I with the assessment of patients with hypopituitarism and patients with pituitary tumors that hypersecrete growth hormone or prolactin. Chronology of experience: MD: University of North Carolina, 1974; Intern and Resident: Massachusetts General Hospital, Boston, MA, 1974-1976; Resident: Johns Hopkins, Baltimore, MD, 1976-1977; Fellowship Endocrinology: Massachusetts General Hospital, Boston, MA, 1977-1979; Assistant Professor of Medicine: University of North Carolina, 1979-1985; Associate Professor of Medicine: University of North Carolina, 1985-1990; Professor of Medicine: University of North Carolina, 1990-1995; Sarah Graham Kenan Distinguished Professor of Medicine: University of North Carolina, 1996-2019; Professor of Medicine: University of North Carolina, 2019-present.
Dr. Clemmons is being referenced as one of the leading scientists involved in the research and development of IGF-1 DES. In no way is this doctor/scientist endorsing or advocating the purchase, sale, or use of this product for any reason. There is no affiliation or relationship, implied or otherwise, between Life Link Research and this doctor. The purpose of citing the doctor is to acknowledge, recognize, and credit the exhaustive research and development efforts conducted by the scientists studying this peptide. Dr. Clemmons is listed in [15] under the referenced citations.

Referenced Citations

  1. F. J. Ballard, J. C. Wallace, G. L. Francis, L. C. Read, and F. M. Tomas, “Des(1-3)IGF-I: a truncated form of insulin-like growth factor-I,” Int. J. Biochem. Cell Biol., vol. 28, no. 10, pp. 1085– 1087, Oct. 1996. 1
  2. F. M. Tomas, P. E. Walton, F. R. Dunshea, and F. J. Ballard, “IGF-I variants which bind poorly to IGF-binding proteins show more potent and prolonged hypoglycaemic action than native IGF-I in pigs and marmoset monkeys,” J. Endocrinol., vol. 155, no. 2, pp. 377–386, Nov. 1997. 
  3. P. E. Walton, F. R. Dunshea, and F. J. Ballard, “In vivo actions of IGF analogues with poor affinities for IGFBPs: metabolic and growth effects in pigs of different ages and GH responsiveness,” Prog. Growth Factor Res., vol. 6, no. 2–4, pp. 385–395, 1995.
  4.  F. J. Ballard, P. E. Walton, S. Bastian, F. M. Tomas, J. C. Wallace, and G. L. Francis, “Effects of interactions between IGFBPs and IGFs on the plasma clearance and in vivo biological activities of IGFs and IGF analogs,” Growth Regul., vol. 3, no. 1, pp. 40–44, Mar. 1993.
  5. R. Canitano, “New experimental treatments for core social domain in autism spectrum disorders,” Front. Pediatr., vol. 2, p. 61, 2014.
  6. J Costales and A. Kolevzon, “The Therapeutic Potential of Insulin-Like Growth Factor-1 in Central Nervous System Disorders,” Neurosci. Biobehav. Rev., vol. 63, pp. 207–222, Apr. 2016. 
  7. R. Riikonen, “Insulin-Like Growth Factors in the Pathogenesis of Neurological Diseases in Children,” Int. J. Mol. Sci., vol. 18, no. 10, Sep. 2017.
  8. A. B. Steinmetz, S. A. Stern, A. S. Kohtz, G. Descalzi, and C. M. Alberini, “Insulin-Like Growth Factor II Targets the mTOR Pathway to Reverse Autism-Like Phenotypes in Mice,” J. Neurosci. Off. J. Soc. Neurosci., vol. 38, no. 4, pp. 1015–1029, 24 2018.
  9. D. Ebrahimi-Fakhari and M. Sahin, “Autism and the synapse: emerging mechanisms and mechanism-based therapies,” Curr. Opin. Neurol., vol. 28, no. 2, pp. 91–102, Apr. 2015. 
  10. D. C. Górecki, M. Beresewicz, and B. Zabłocka, “Neuroprotective effects of short peptides derived from the Insulin-like growth factor 1,” Neurochem. Int., vol. 51, no. 8, pp. 451–458, Dec. 2007.
  11.  M. M. Ramsey, M. M. Adams, O. J. Ariwodola, W. E. Sonntag, and J. L. Weiner, “Functional characterization of des-IGF-1 action at excitatory synapses in the CA1 region of rat hippocampus,” J. Neurophysiol., vol. 94, no. 1, pp. 247–254, Jul. 2005.
  12. X. Zhao, B. W. McBride, L. M. Trouten-Radford, and J. H. Burton, “Effects of insulin-like growth factor-I and its analogues on bovine hydrogen peroxide release by neutrophils and blastogenesis by mononuclear cells,” J. Endocrinol., vol. 139, no. 2, pp. 259–265, Nov. 1993.
  13. M. E. Yateman, D. C. Claffey, S. C. Cwyfan Hughes, V. J. Frost, J. A. Wass, and J. M. Holly, “Cytokines modulate the sensitivity of human fibroblasts to stimulation with insulin-like growth factor-I (IGF-I) by altering endogenous IGF-binding protein production,” J. Endocrinol., vol. 137, no. 1, pp. 151–159, Apr. 1993.
  14. M. Remacle-Bonnet, F. Garrouste, F. el Atiq, M. Roccabianca, J. Marvaldi, and G. Pommier, “des- (1-3)-IGF-I, an insulin-like growth factor analog used to mimic a potential IGF-II autocrine loop, promotes the differentiation of human colon-carcinoma cells,” Int. J. Cancer, vol. 52, no. 6, pp. 910–917, Dec. 1992.
  15. J Clin Invest. 2004;113(1):25-27. https://doi.org/10.1172/JCI20660.

$106.00

Description

IGF-1 DES, a potent form of Insulin-like Growth Factor 1, enhances muscle growth and repair, improves fat metabolism, accelerates recovery, provides neuroprotective effects, and supports bone health (PMID: 21135066,PMID: 8970554, PMID: 31525624, PMID: 8603600, PMID: 25147565 ).

IGF-1 DES, a truncated form of Insulin-like Growth Factor 1, has several notable benefits:

  1. Enhanced Muscle Growth and Repair: IGF-1 DES is significantly more potent than IGF-1 in promoting muscle hypertrophy. It stimulates muscle cell proliferation and differentiation, leading to increased muscle mass and strength, making it popular among bodybuilders and athletes​ (PMID: 21135066)​.
  2. Improved Fat Metabolism: This peptide enhances fat breakdown and reduces fat storage, which helps in improving body composition and reducing overall body fat​ (PMID: 8970554)​.
  3. Accelerated Recovery: IGF-1 DES aids in faster recovery from exercise and injuries by promoting cellular repair processes and reducing muscle damage​ (PMID: 31525624)​.
  4. Neuroprotective Effects: It has shown potential in protecting neurons from damage, which could be beneficial in neurodegenerative conditions​ (PMID: 8603600)​.
  5. Bone Health: IGF-1 DES supports bone growth and repair, contributing to stronger bones and potentially aiding in the treatment of conditions like osteoporosis​ (PMID: 25147565)​.

Peer-Reviewed Studies 

Pan, W., & Kastin, A. J. (2000) Neuroendocrinology, 72(3), 171-178.

Kummer, A., Pulford, B. E., Ishii, D. N., & Seigel, G. M. (2003). Experimental Diabesity Research, 4(1), 45-57.

 

Structure

Sequence:

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKS

A Molecular Formula: C H N O S

Molecular Weight: 7365.4225 g/mol

PubChem CID: 135331146

CAS Number: 112603-35-7

Synonyms: Insulin-like growth factor 1, des-(1-3)-, Des(1-3) IGF-1, 4-70-insulin-like growth factor 1

IGF-1 DES Research

IGF-1 DES Is More Potent Than IGF-1

IGF-1 DES lacks just three amino acids from its N-terminal end, but that subtle change makes a big difference. Research shows that IGF-1 DES does not bind very well to IGF-1 binding proteins (IGFBPs) found in the blood and in various tissues throughout the body. The result is that more of the peptide is available for binding to important receptors and thus IGF-1 DES is more potent (same effects at lower doses) than IGF-1 itself. Research in pigs and marmosets indicates that IGF-1 DES is 2-3 times more potent than IGF-1 in lowering blood sugar. Further, these same potency effects extend to other properties of IGF-1 as well, including its anabolic effects on skeletal muscle and its neuroprotective effects [2].

One of the benefits of binding to IGFBPs is prolonged activity as a result of decreased clearance from the circulation. Thus, IGF-1 DES has a much faster onset of action, higher peak activity, and faster withdrawal than IGF-1 itself. There are a number of settings in which this type of efficacy profile could be useful, including the treatment of hyperglycemic conditions.

Research in pigs indicates that IGF-1 variants with low affinities for IGFBPs have a more dramatic effect on growth. In fact, the anabolic effects of IGF-1 DES occur even in the setting of limited calorie intake[3]. Research in rats shows that just 14 days of IGF-1 DES is enough to produce significant increases in body weight, nitrogen retention, and food conversion efficiency[4]. The latter fact is important as it confirms the potential of IGF-1 DES to improve anabolism even in the setting of poor calorie intake, a function that would make the peptide useful in chronic disease and in individuals who are unable to consume a great deal of calories for a variety of reasons. IGF-1 has also been shown to be a more effective antihyperglycemic agent, lower blood sugar rapid after administration. This is part of the reason the peptide is so efficient in boosting growth with lower calorie consumption. There is interest among researchers in using IGF-1 DES as a potential treatment in hyperglycemia were it would have similar effects to insulin administration without the long-term side effects that can occur if too much insulin is used.

IGF-1 DES Research and Neurological Disease

It has been long established that IGF-1 has important effects on neuron growth, differentiation, and survival. The protein is a major factor in synaptic formation and thus plays a critical role in learning, memory, and more. IGF-1 is particularly important for the development and maintenance of mature synapses. Research shows that IGF-1 is absolutely necessary for achieving proper levels of presynaptic synapsin-1, a protein that regulates the release of neurotransmitters. The peptide is also important for the post-synaptic PSD-95 protein, which maintains synaptic structure. Without IGF-1, synaptic development is disrupted and deficits in motor skills, behavior, cognitive functioning, and language all develop.

Source: Pubmed
IGF-1 and its analogues have been tested in Rett syndrome and in chromosome 22 deletion syndrome. In both cases, the peptides yield positive benefits. By protecting the number of excitatory synapses in the brain and by preserving neuron density. IGF-1 has also been shown to reduce the toxic effects of NDMA over-stimulation, thereby protecting neurons from excitotoxicity, which can lead to neuron death. The benefits were so great in animal studies that IGF-1 and its analogues are being introduced as experimental treatments in humans suffering from these devastating conditions[5].
Clinical trials of IGF-1 in multiple sclerosis (MS), ALS, Parkinson’s disease (PD), and Alzheimer’s disease (AD) have yielded mixed results. In ALS, for instance, IGF-1 treatment lead to significant reductions in disease progression, increased muscle strength, improved respiratory functioning, and increased quality of life. In MS, the peptide had almost no effect. Human trials of IGF-1 in PD have not yet been performed, but studies in rat models of PD indicate that it protects dopaminergic neurons and improves behavior[6]. Further study is required to understand the causes of these conditions and how IGF-1 DES plays a role in their treatment. The fact that the peptide has no impact on MS is not surprising as the condition is less caused by neuron death than by damage to the cells around neurons. IGF-1 DES and other IGF-1 analogues can help scientists to explore the basic pathophysiology of these conditions in order to better under their causes and thus develop potential treatments.
IGF-1 DES and Autism
Research shows that IGF-1 may be an important constituent in a number of neurological conditions, including autism. In fact, children with autism show lower brain levels of IGF-1 than age-matched controls, suggesting that low IGF-1 concentrations in the brain, particularly at an early age, may disrupt normal development and be important in the pathogenesis of autism [7].
Research in mouse models of autism indicate that IGF-II and analogues like IGF-1 DES reverse all deficits associated with the conditions. Mice administered IGF-II for just five days showed improved social interaction, better novel-object recognition, enhanced contextual fear conditioning, reduced repetitive/compulsive behavior, better grooming, and more. The mice even showed improve memory[8].
These findings should not come as any surprise as research suggests that autism is likely caused by disruptions in synapse development and is similar pathologically, to other neurodevelopmental conditions like fragile X syndrome, tuberous sclerosis, and Angelman syndrome. IGF-1 and its analogues, which have potent effects on synapses, are therefore ideal candidates for exploring various treatment strategies in these disorders[9].
IGF-1 DES May Have Cognitive Benefits in Age
IGF-1 is important in adults as well as children. In adults, the peptide is actually heavily modified in the brain to make it shorter, indicating that analogues like IGF-1 DES may have better therapeutic potential than intact IGF-1. Molecules like IGF-1 DES also penetrate the blood-brain barrier more readily, making them more effective when administered exogenously. In adults, IGF-1 and its analogues have been shown to reduce neuronal death and protect neurons against insults like stroke, Alzheimer’s disease, Parkinson’s disease, and more[10].
From the above, it is clear that IGF-1 and its analogues are useful in the setting of neurological disease. Research in rats, however, suggests that IGF-1 DES may enhance synaptic transmission and impart cognitive benefits even in normal rats. This could be of benefit to learning and memory, particularly as organisms age and natural levels of IGF-1 in the brain begin to decline. According to research, IGF-1 DES causes a 40% increase in excitatory post-synaptic potential[11]. This suggests that the peptide could have profound effects on cognitive function, particularly in age-related synaptic dysfunction.

IGF-1 DES Research and Immune Function

Many cells in the immune system, such as mononuclear cells and neutrophils, have IGF-1 receptors on their surface. Research shows that IGF-1 DES can improve immune function by boosting release of hydrogen peroxide in mononuclear cells and by encouraging neutrophils to differentiate into pathogen-killing blastocytes[12]. In all cases, IGF-1 DES is more potent in stimulating these changes than IGF-1, indicating that the peptide might be an effective adjuvant to antibiotics and other treatments used in the setting of infectious disease. Research into the role of IGF-1 DES in stimulating immune function is very preliminary, but still very promising.

IGF-1 DES May Improve Wound Healing

Dermal (skin) fibroblasts are the cell primarily responsible for tissue repair following injury. These cells turn out to produce a number of IGFBPs under certain circumstances and it is known that this protein drastically lowers the impact of IGF-1 at its other receptors. Research suggests that inflammatory cytokines can alter IGFBP levels, which may impact healing. By administering peptides that are unaffected by IGFBP, it is possible to circumvent the effects of inflammatory cytokines and improve fibroblast growth and differentiation[13]. This, in turn, can accelerate wound healing.

IGF-1 DES Research and Cancer

One of the problems that cancer cells present is the fact that they are undifferentiated or exist at very earlier stages of differentiation. This makes the cells difficult to treat and also makes them dysfunctional. Most importantly, cells in later stages of differentiation grow more slowly. Forcing cancer cells to differentiate could slower tumor growth. Research in cell culture indicates that IGF-1 DES can force certain types of cancer cell to differentiate, which slows tumor growth by inhibiting differentiation[14].

IGF-1 DES Is a New Contender

IGF-1 DES preserves many of the functions of IGF-1, such as enhanced skeletal muscle growth and protection of neurons. It is different, however, in that it does not bind to IGFBPs. This fact alone makes IGF-1 DES more useful in a number of ways, such as allowing the peptide to more easily pass into the brain when administered exogenously. IGF-1 DES hold a great deal of promise, which is why it is the subject of intense research in fields that touch on neurodevelopment, stroke, cancer, wound healing, autism, and more.
IGF-1 DES exhibits moderate side effects, low oral and excellent subcutaneous bioavailability in mice. Per kg dosage in mice does not scale to humans. IGF-1 DES for sale at Life Link Research is limited to educational and scientific research only, not for human consumption.

Article Author

The above literature was researched, edited and organized by Dr. Logan, M.D. Dr. Logan holds a doctorate degree from Case Western Reserve University School of Medicine and a B.S. in molecular biology.

Scientific Journal Author

Dr. Clemmons’ clinical practice combines his interest in growth hormone and IGF-I with the assessment of patients with hypopituitarism and patients with pituitary tumors that hypersecrete growth hormone or prolactin. Dr. Clemmons combines basic biomedical research, clinical investigation and consultative endocrinology practice as well as clinical education. His basic research involves understanding the molecular mechanisms by which insulin-like growth factors stimulate cellular proliferation and differentiation. Dr. Clemmons is also interested in how cells that are undergoing hyperglycemic stress respond aberrantly to stimulation by these growth factors. Additionally, he is interested in the mechanisms by which these factors stimulate differentiation particularly in osteoblasts and vascular cells. His clinical studies involve novel methods for reversing the effect of these factors in patients with diabetic nephropathy and retinopathy. In his clinical practice he combines his interest in growth hormone and IGF-I with the assessment of patients with hypopituitarism and patients with pituitary tumors that hypersecrete growth hormone or prolactin. Chronology of experience: MD: University of North Carolina, 1974; Intern and Resident: Massachusetts General Hospital, Boston, MA, 1974-1976; Resident: Johns Hopkins, Baltimore, MD, 1976-1977; Fellowship Endocrinology: Massachusetts General Hospital, Boston, MA, 1977-1979; Assistant Professor of Medicine: University of North Carolina, 1979-1985; Associate Professor of Medicine: University of North Carolina, 1985-1990; Professor of Medicine: University of North Carolina, 1990-1995; Sarah Graham Kenan Distinguished Professor of Medicine: University of North Carolina, 1996-2019; Professor of Medicine: University of North Carolina, 2019-present.
Dr. Clemmons is being referenced as one of the leading scientists involved in the research and development of IGF-1 DES. In no way is this doctor/scientist endorsing or advocating the purchase, sale, or use of this product for any reason. There is no affiliation or relationship, implied or otherwise, between Life Link Research and this doctor. The purpose of citing the doctor is to acknowledge, recognize, and credit the exhaustive research and development efforts conducted by the scientists studying this peptide. Dr. Clemmons is listed in [15] under the referenced citations.

Referenced Citations

  1. F. J. Ballard, J. C. Wallace, G. L. Francis, L. C. Read, and F. M. Tomas, “Des(1-3)IGF-I: a truncated form of insulin-like growth factor-I,” Int. J. Biochem. Cell Biol., vol. 28, no. 10, pp. 1085– 1087, Oct. 1996. 1
  2. F. M. Tomas, P. E. Walton, F. R. Dunshea, and F. J. Ballard, “IGF-I variants which bind poorly to IGF-binding proteins show more potent and prolonged hypoglycaemic action than native IGF-I in pigs and marmoset monkeys,” J. Endocrinol., vol. 155, no. 2, pp. 377–386, Nov. 1997. 
  3. P. E. Walton, F. R. Dunshea, and F. J. Ballard, “In vivo actions of IGF analogues with poor affinities for IGFBPs: metabolic and growth effects in pigs of different ages and GH responsiveness,” Prog. Growth Factor Res., vol. 6, no. 2–4, pp. 385–395, 1995.
  4.  F. J. Ballard, P. E. Walton, S. Bastian, F. M. Tomas, J. C. Wallace, and G. L. Francis, “Effects of interactions between IGFBPs and IGFs on the plasma clearance and in vivo biological activities of IGFs and IGF analogs,” Growth Regul., vol. 3, no. 1, pp. 40–44, Mar. 1993.
  5. R. Canitano, “New experimental treatments for core social domain in autism spectrum disorders,” Front. Pediatr., vol. 2, p. 61, 2014.
  6. J Costales and A. Kolevzon, “The Therapeutic Potential of Insulin-Like Growth Factor-1 in Central Nervous System Disorders,” Neurosci. Biobehav. Rev., vol. 63, pp. 207–222, Apr. 2016. 
  7. R. Riikonen, “Insulin-Like Growth Factors in the Pathogenesis of Neurological Diseases in Children,” Int. J. Mol. Sci., vol. 18, no. 10, Sep. 2017.
  8. A. B. Steinmetz, S. A. Stern, A. S. Kohtz, G. Descalzi, and C. M. Alberini, “Insulin-Like Growth Factor II Targets the mTOR Pathway to Reverse Autism-Like Phenotypes in Mice,” J. Neurosci. Off. J. Soc. Neurosci., vol. 38, no. 4, pp. 1015–1029, 24 2018.
  9. D. Ebrahimi-Fakhari and M. Sahin, “Autism and the synapse: emerging mechanisms and mechanism-based therapies,” Curr. Opin. Neurol., vol. 28, no. 2, pp. 91–102, Apr. 2015. 
  10. D. C. Górecki, M. Beresewicz, and B. Zabłocka, “Neuroprotective effects of short peptides derived from the Insulin-like growth factor 1,” Neurochem. Int., vol. 51, no. 8, pp. 451–458, Dec. 2007.
  11.  M. M. Ramsey, M. M. Adams, O. J. Ariwodola, W. E. Sonntag, and J. L. Weiner, “Functional characterization of des-IGF-1 action at excitatory synapses in the CA1 region of rat hippocampus,” J. Neurophysiol., vol. 94, no. 1, pp. 247–254, Jul. 2005.
  12. X. Zhao, B. W. McBride, L. M. Trouten-Radford, and J. H. Burton, “Effects of insulin-like growth factor-I and its analogues on bovine hydrogen peroxide release by neutrophils and blastogenesis by mononuclear cells,” J. Endocrinol., vol. 139, no. 2, pp. 259–265, Nov. 1993.
  13. M. E. Yateman, D. C. Claffey, S. C. Cwyfan Hughes, V. J. Frost, J. A. Wass, and J. M. Holly, “Cytokines modulate the sensitivity of human fibroblasts to stimulation with insulin-like growth factor-I (IGF-I) by altering endogenous IGF-binding protein production,” J. Endocrinol., vol. 137, no. 1, pp. 151–159, Apr. 1993.
  14. M. Remacle-Bonnet, F. Garrouste, F. el Atiq, M. Roccabianca, J. Marvaldi, and G. Pommier, “des- (1-3)-IGF-I, an insulin-like growth factor analog used to mimic a potential IGF-II autocrine loop, promotes the differentiation of human colon-carcinoma cells,” Int. J. Cancer, vol. 52, no. 6, pp. 910–917, Dec. 1992.
  15. J Clin Invest. 2004;113(1):25-27. https://doi.org/10.1172/JCI20660.

Reviews

There are no reviews yet.

Be the first to review “IGF-1 DES 1mg”

Your email address will not be published. Required fields are marked *

Related Products

Subscribe to our Newsletter

Follow us by

+7 (098) 508-88-66

Leave a message
logo-footer

Lorem ipsum dolor sit amet, consectetur adipi scing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

Ut enim ad minim veniam, quis nostrud exeri itation ullamco laboris nisi ut aliquip ex ea commodo consequat.

Contact Info

Call us free:

1800 446 000

561 Wellington Road, Street 32, San Francisco

pharmacy@gmail.com

Hours: 10:00 – 18:00, Mon – Sat

Twitter Facebook-f Instagram Youtube

infomation

Customer services

payment
Pharmacy © 2024 copyright. Designed by MagenTech.Com
x

Daily Promotion

Sign up newsletter